PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055011.160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 319aa    MW: 35113.8 Da    PI: 9.7924
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055011.160genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.96.9e-19175208134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    C+ C+t+kTplWR+gp g+ktLCnaCG+++rk +
  EcC055011.160 175 CVDCNTSKTPLWRSGPKGPKTLCNACGIRQRKAR 208
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.2E-18169220IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.861169205IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.47E-12170209No hitNo description
Gene3DG3DSA:3.30.50.107.0E-16173208IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.63E-12174206No hitNo description
PfamPF003202.2E-16175208IPR000679Zinc finger, GATA-type
PROSITE patternPS003440175200IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0006535Biological Processcysteine biosynthetic process from serine
GO:0006812Biological Processcation transport
GO:0055085Biological Processtransmembrane transport
GO:0055114Biological Processoxidation-reduction process
GO:0005737Cellular Componentcytoplasm
GO:0009505Cellular Componentplant-type cell wall
GO:0009506Cellular Componentplasmodesma
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004565Molecular Functionbeta-galactosidase activity
GO:0004713Molecular Functionprotein tyrosine kinase activity
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0009001Molecular Functionserine O-acetyltransferase activity
GO:0015299Molecular Functionsolute:proton antiporter activity
GO:0016491Molecular Functionoxidoreductase activity
GO:0030246Molecular Functioncarbohydrate binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MTPDDHTREL NEYQEESLAS RPQPHHHRQA TSPCFSSIIT PNYVLHSSVE EQGGCFHRAS  60
QPSDRGLEAL PAPISITTSQ KLEDQRVEED HQKGRHEHSS SSSSSSSSPP FKWTSSKMRM  120
MRKMRKMMIS EKRPPPNKSS AHESEDQPYP DSITLSCPQM DSNGGCSGNT AVRVCVDCNT  180
SKTPLWRSGP KGPKTLCNAC GIRQRKARRA MAAAAAAANG TVVPTPTMTL PAKCKLKNKD  240
NKRPGSKATI DQESETIKKR FKLSPPTLAS SKGTKQLCLE DFAARLSKRY SANLQRVFPQ  300
EEKEAAILLM ALSCGLVHG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047576.10.0PREDICTED: GATA transcription factor 21-like
TrEMBLA0A059CM450.0A0A059CM45_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26150.16e-27cytokinin-responsive gata factor 1